Basic Information | |
---|---|
Taxon OID | 3300017815 Open in IMG/M |
Scaffold ID | Ga0188954_11628 Open in IMG/M |
Source Dataset Name | Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1459 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | village of Ngallou, Senegal | |||||||
Coordinates | Lat. (o) | 14.0491 | Long. (o) | -16.7624 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049200 | Metagenome | 147 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188954_116283 | F049200 | N/A | MDDLELGQRLALPYETEKKCISVPATVTGIGLPVVRVQTEDGETYIRHARKVTKWTHDRSHA |
⦗Top⦘ |