Scaffold Ga0169931_10279492

Overview

Basic Information

• Taxon OID: 3300017788
• Scaffold ID: Ga0169931_10279492
• Source Dataset Name: Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1333
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Rwanda: Western Province
• Coordinates
  • Lat. (^o): -1.78
  • Long. (^o): 29.2
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051073	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169931_102794924	F051073	GAG	MTFELVKGSGTRFTSTVVIDKHNADAQVWWCEGKQEWHWTLIWEDGGPYGTHVHNGIAPTKQKARADIVRTILWIEDRWPTHEYFDFAY