Basic Information | |
---|---|
Taxon OID | 3300017785 Open in IMG/M |
Scaffold ID | Ga0181355_1258979 Open in IMG/M |
Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 665 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan | |||||||
Coordinates | Lat. (o) | 43.1881 | Long. (o) | -86.344 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042184 | Metagenome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0181355_12589792 | F042184 | AGG | MEFDIDFCYLEIDIKTWVEWEYDPEYSPDEGIHDKFIWSAYLMVGDKRIDITDDLSSKESKSIEKQIEEISRDCI |
⦗Top⦘ |