| Basic Information | |
|---|---|
| Taxon OID | 3300017785 Open in IMG/M |
| Scaffold ID | Ga0181355_1146429 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 955 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1881 | Long. (o) | -86.344 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059778 | Metagenome | 133 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181355_11464293 | F059778 | AGGA | MKDDLLEKALQYAKHDDYVVTRKIITDLCNEIERLRELNRDVFSRIQDNKEIFNNAERYLWLRNAAWDVPPMAYAPVVVLCDNKMVTWEWLDGTALDLTVDKWRNDVTL |
| ⦗Top⦘ |