Scaffold Ga0181348_1309134

Overview

Basic Information

• Taxon OID: 3300017784
• Scaffold ID: Ga0181348_1309134
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 527
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Curvibacter → Curvibacter lanceolatus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698
  • Depth (m): 110

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098638	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181348_13091342	F098638	GGAGG	MTSRQQFELEHFNISPAKVGRRNPAFWIHQAPSAWRKSMKYWAALWLGFVLGAIGAGALVVIAGVVR