| Basic Information | |
|---|---|
| Taxon OID | 3300017784 Open in IMG/M |
| Scaffold ID | Ga0181348_1007369 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4823 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1998 | Long. (o) | -86.5698 | Alt. (m) | Depth (m) | 110 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019079 | Metagenome / Metatranscriptome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181348_10073691 | F019079 | AGGA | MKKIFAILALAISGTAFAADTFTVESQRINNAGAAAQQQYVLGIKKDFTGFAGDLAFSNAQTDGTNALSTRIEAGATVAGPVGLYARVATGQKYSNTADFTYYSVEPGIAVAVPGVAGLTAKAGVRFRSAFQSANNDQTHTARYSLAYALSKNDTVA |
| ⦗Top⦘ |