NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181423_1015559

Scaffold Ga0181423_1015559


Overview

Basic Information
Taxon OID3300017781 Open in IMG/M
Scaffold IDGa0181423_1015559 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3146
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018269Metagenome236N
F073156Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0181423_10155594F018269GAGLVAKRYKMKIGINLVGVSYNNAITGGRLRNYEDAIENFFKYIIEPFREKGHEVSFYLYSYENEKQDKIVNDYNPCIKSQFVKQDYNKLGGGDKVSEGYKVMSVSYLNSLEQLKNQDLDLIISTRYDIKFLKNPFEEYNFDFDKMNFLWREPELKHLPIVNDTFLVFPYKMLDNVIDSIIEMEENPPHGKNIAMHNWYLPMVNQVGEDKVQWVDDEFRTAIENELYILTRKA
Ga0181423_10155596F073156N/AMDDDTYTILGCITKYKADDIRPYVESIEQTGFKGRKVMLVYDVPQETIDYLKSKGWDLFGGELQQHIILQRFRDLYKLLGSEIKGTVIW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.