NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181394_1000345

Scaffold Ga0181394_1000345


Overview

Basic Information
Taxon OID3300017776 Open in IMG/M
Scaffold IDGa0181394_1000345 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21201
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003637Metagenome / Metatranscriptome476Y
F020921Metagenome / Metatranscriptome221Y
F104998Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0181394_100034515F104998AGGAMSYLEFVQQEKSDKHGMYVPEIQCSYCGNNKDGDSPAISVNECEVCEERDWQSSCCTSPPFGNSFIEEEETGICSKCYDGANFNDLNKEE
Ga0181394_10003453F003637AGGAGMSKVISEKVQESNPAEVIKQVEIKHTRTMKDASGNDVVVVDHVEVKNIDDAISQSEKDKARLEAQLAEVTAELADYIAIRDAE
Ga0181394_10003454F020921GAGMATPTVPTTNVGMYNHLREATDCNQTTNLSLASLCNGGTYNGIQNTFGGQGGRAMFFDVIGGTNNPITTTPNSVNLYDDIIGTAPFNLANTIGGRYT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.