NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181432_1068290

Scaffold Ga0181432_1068290


Overview

Basic Information
Taxon OID3300017775 Open in IMG/M
Scaffold IDGa0181432_1068290 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1022
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005832Metagenome / Metatranscriptome389Y
F018813Metagenome / Metatranscriptome233Y
F070548Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0181432_10682901F070548N/AMANWDSRELQTPPAIKKIGENAQNVINNLDILLKLVKGGANVAKLFLLLSNPAGAIIKLAANEIIKLANDFKEIGVFYLFINPNDDGYGNQTTRELGLAIKRDGLT
Ga0181432_10682902F005832AGGTGGMSKEGLWQDSKGMKDSEIVEKWTNVLHTVEYAMKQLEYQKTALIKKKEDIVNSEENKNG
Ga0181432_10682903F018813AGGAGMTMPCSITGDMSIGHAGFSPAPITPTGGPTAKVLVMGAPPHVANDLIGPHVLGLSVHTGTVLEVSTTVLAGGLGLARLMDKGDCQSLILGSAATVMVGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.