NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181425_1047130

Scaffold Ga0181425_1047130


Overview

Basic Information
Taxon OID3300017771 Open in IMG/M
Scaffold IDGa0181425_1047130 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1406
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032867Metagenome / Metatranscriptome179Y
F042853Metagenome / Metatranscriptome157N
F047975Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0181425_10471304F047975AGGAGGMRITKEEWAENTVDDMEWKDLARIVYDVMLDSVKDMSDKEFKEYLIECGYDEELI
Ga0181425_10471305F032867AGGAGMDELEKMIDNLVDNHYDSQHLIGTEADESEYLADIEEEDDENN
Ga0181425_10471308F042853N/AYIATIEVEADSKREAIRYAHSDENQHIANHNEDYFYHFEDLLHKPTVARFKSYEEQYPEEVKQCQENK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.