NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181344_1002032

Scaffold Ga0181344_1002032


Overview

Basic Information
Taxon OID3300017754 Open in IMG/M
Scaffold IDGa0181344_1002032 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7270
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025263Metagenome / Metatranscriptome202Y
F099215Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0181344_10020326F025263AGGGGGMTINPNQLQVAKIYPGNYTNVLRYWHDPKSVPNISANDTAETLTNQPVGGPVGVVIQPGWIAQQAIGYVDLSYQANGSVNQLEYYTQPYGSGLNGSNQAFISANVIIPSPDYHKDVRADIADGITVPSGALVYRASLRVDGGDVISSGVGGGSATPQLSLTPAVSQGIRNDGTVVSGQFAVSVTGANSRIANGSVNSVNIFNSTNLSRLSAYTTWRLVATRNLGGVVASGLAQASGTFDPRAQAGKLSGKNKALAICELCWIVPDAPPKRDDVVLQPAGVVESSIYTSTVPA
Ga0181344_10020328F099215N/AVGYIPLSNYKYATGLHRIQSGPVSEGFIVLSSGIQDIGADLGIVAPGPMTSGVYSTTAWRSVPPAVSGYWTDFQDSDYQASGVLSVYNGYRALSVTTIANAKVQTSLGPEFGIRDAGKYTYFGGSAPDNQDYTPYNTPEGNTAAQGKTGGGVTHGRYEGGLLTNSLGSQGTANRAEWVYNPPVYCKTYTETIRSTAPGLMSAALRYIYRGGAARYVSNYGSIYLQGSEGVRNLVRTFSPSVNSSNQKSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.