NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181407_1000582

Scaffold Ga0181407_1000582


Overview

Basic Information
Taxon OID3300017753 Open in IMG/M
Scaffold IDGa0181407_1000582 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12319
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (16.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094420Metagenome / Metatranscriptome106Y
F096047Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0181407_100058219F094420GAGMDEVLDGKPLEAEMWKLNYIENLLHYTSITASEQQRIMSSLNEITDIEADEILKKIKENEIHSDPKHQYEAMRKNGMFNPKDY
Ga0181407_10005826F096047GGAMPSPIYRVIVEFGYKKKGSVRQYKYQKIDTFVLTNDIEMIKKDKSLMQRILRKTKSGKKELDITFKNIYVEGQYGETAY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.