NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181400_1041453

Scaffold Ga0181400_1041453


Overview

Basic Information
Taxon OID3300017752 Open in IMG/M
Scaffold IDGa0181400_1041453 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1451
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003976Metagenome / Metatranscriptome459Y
F004856Metagenome / Metatranscriptome421Y
F015812Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0181400_10414531F003976N/ALYREYEYEKECILETLDKLEMSVRFLSVWVNEPKGLINAKYVLEKNSNRTYNLLDENMVKDLLEEVNDG
Ga0181400_10414533F004856AGGAGGMMSDWIEGTKPKYIEARYSAYISWDLDELGIDWDDIEDWDLLRADLHITFKNGTQKVYENWQDLDIDYKHNFEEVLILDEDWHEVEGLNXXTNIKNFTKQ
Ga0181400_10414536F015812GAGGMNRTLYKKLEDICAREYVVNKLSEDKFRTFVDFLYDDIRTWDRPTDVSDVDVIHRIEEHLSYMVSRRLADTHIGTNH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.