Scaffold Ga0181400_1008976

Overview

Basic Information

• Taxon OID: 3300017752
• Scaffold ID: Ga0181400_1008976
• Source Dataset Name: Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3525
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.55
  • Long. (^o): -118.4
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066664	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181400_10089762	F066664	N/A	MTQTNKISIRDRMQNKALSAFGEIEYEIDAWLDLPYGSEFNMLKHLKRLDYSPKVIAFMKGQVDDIIFEVKNEEGCEQLEEAYEFLSKTNKKKFLKFLESIDKGIEEYIATTVVVRKPKIRTPKQLVKTLPFLKQHGKYHSIDPEEIIRAKTLFTYNIASQKFTKFETYGGLSVKGSRIIDYDVCEEKTLTDIKLLDRIYKGGNIIARGFLDEIPRSKLKDGNDLLTKNTLLIKVIR