NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181427_1005868

Scaffold Ga0181427_1005868


Overview

Basic Information
Taxon OID3300017745 Open in IMG/M
Scaffold IDGa0181427_1005868 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3076
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029471Metagenome / Metatranscriptome188N
F048362Metagenome / Metatranscriptome148N
F073589Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0181427_10058682F048362AGGAGMLIKLQNWLMNVAAKWLWIAIMLPIRIILGLIFAVSKHMPTKVELPYKVVKNEQRQEKWY
Ga0181427_10058683F029471AGGAGMLSSELNQQDYSDSRLDDMQDVLDCVDMKAGIKTFFDTVISPFADHQDWTMLAEWNANSIIGVFQRHHEQCIKSLDKTRDLMKNAMREDVGNEITKLNVDKLIFRRDAQEVNIKRAEAILNEFHICYEVTFGKKFMPQSKTPAKDVTKQMKEYNVARLKEALGQK
Ga0181427_10058686F073589AGGAGMNYKVNIWQDDTLKREIVYSAENDIQAIQMASAATPDGCRSTYEQVMEDKCPTEKEPMVQKEEDLLQKAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.