NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181365_1050196

Scaffold Ga0181365_1050196


Overview

Basic Information
Taxon OID3300017736 Open in IMG/M
Scaffold IDGa0181365_1050196 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1043
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)108
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070109Metagenome / Metatranscriptome123Y
F077297Metagenome / Metatranscriptome117Y
F084221Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0181365_10501961F084221N/AMSHQQQVAQGVTGTVSSILLSVPAWMLDVEFALKIFCLILSAAASIYTIYKMRKKR
Ga0181365_10501963F077297GAGLAKRNQMTQPTREQISAGVIIIIAVAICIFMQLMYIRIKEDEKALEGYERRADRATHVIDSLEATNVQRMQEIAQLNMQIEHNTKRYEANISAIDSLDRNGLKRAMHNLLTSLAGERYPGESND
Ga0181365_10501964F070109N/AVRDTLVSLTTSEVRSLLKLKAERDYLLEQNLLLSKSDKIASSVIKDQAKTIDAYSIANEQKAQQLVKVQQELYKEAARKESWRSAALIGIPISFVGGIIFNLLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.