NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181415_1086258

Scaffold Ga0181415_1086258


Overview

Basic Information
Taxon OID3300017732 Open in IMG/M
Scaffold IDGa0181415_1086258 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)708
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002495Metagenome / Metatranscriptome554Y
F068127Metagenome / Metatranscriptome125Y
F071633Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0181415_10862581F068127N/AALYSDWKKQNDSIEKDFESQQQSIKQNGGQNVRQW
Ga0181415_10862582F002495GGAGGMSDNGSGKQKDWVLFPYDANNEKAIKIDFSGNVNLDNGNKGTILGVKGASRDGNTKFVKVFAQVGVLFKGDDKFTGEMNYAEAGGHKGLIGWINESGNILSGYKNEPRPKQAKPQSKEIP
Ga0181415_10862583F071633N/ALKVVFLILVIYSGDGNLKYEKIPFAYSLLPITCDEMYEKNVKYVENPNYKEGNGEVWVLTKYKNQNVMAYYCKDEKGNYVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.