Scaffold Ga0181417_1006279

Overview

Basic Information

• Taxon OID: 3300017730
• Scaffold ID: Ga0181417_1006279
• Source Dataset Name: Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3182
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.55
  • Long. (^o): -118.4
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066698	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181417_10062792	F066698	GAGG	MKYPCQGPNWHTRPTKDRFNKSTKRLKGRNAYFSMDHGNGTFAIFCTTGCQNDWINANIQNIVAQRPITFNRERKLSEQTYHLTEGNWLRSDEHLTND