NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181396_1000781

Scaffold Ga0181396_1000781


Overview

Basic Information
Taxon OID3300017729 Open in IMG/M
Scaffold IDGa0181396_1000781 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7092
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006939Metagenome / Metatranscriptome361N
F030435Metagenome / Metatranscriptome185Y
F033796Metagenome / Metatranscriptome176N
F086976Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0181396_100078110F006939AGAAGGMTLPLNMVTNVLSENQNKFITVKFLTKDNEERTYTGRMNVIKGLKGNEKGRVVAEALRKAGYITLKTKQGYKCFNVDRVLGFVAGGRRIFGLGTEV
Ga0181396_100078111F033796AGGAMSSRDENKTYKVAGINKGKGKGVTVLDGRKRVLEEAEQSAKLLTGKYALENSIGISNFVAFNTHALTMLPPYSIDMEAEWNYVVEQEGQEDTPSVEINRQAEGSI
Ga0181396_100078113F086976N/AGNKVYKTETELTKGLLNDEIPHELYVELIKVYHEAYEEAPEYGFTGVGCISFAESMLQYHQDGVERRIRTPQLYDEYSFKQESNDE
Ga0181396_10007816F030435N/AMNNQDILDMCRRLASKYYNHQDYDDIVSEGVVLCLKMRAEGITDPPKLYYSARTVMYEYVNVSLSKLSYPKGRFGRDAAVTDTTVYVEPDEAQIPADDLFGSYELKDSIETLKKELSDREWKVFLVLYNNNNNITEASKALGMSRMHLNTMRNDIRDKLVTICDITL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.