NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181419_1002272

Scaffold Ga0181419_1002272


Overview

Basic Information
Taxon OID3300017728 Open in IMG/M
Scaffold IDGa0181419_1002272 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6357
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (84.21%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030435Metagenome / Metatranscriptome185Y
F033796Metagenome / Metatranscriptome176N
F053299Metagenome / Metatranscriptome141N
F072342Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0181419_100227210F033796GAGGMAENKTYKVAGVHSGKKGVTVLEGNKRVLEEAEQSAKSLNGKYALENSLGITNFVAFNTHALTMLPPYSIDMEAEWNYVVEQEGDDTPSVEINRQIEGSI
Ga0181419_100227211F072342AGGAGMSKQVDWHKARVKKQMKTKKVLKQMSIEQREAIEEIQKSVASCLEMIKDCNDLYMSDVAKLESSWHSLRWAFEVDEV
Ga0181419_10022722F030435N/AMNNKDILDMCRRLASKYYNHQDYDDIVSEGVVLCLKMRAEGIKEPSKLYYNARTAMFQYVNVGMSQLSYPKGMAGREAVLEDTIEYVVSDEVDIPSEDLYGSYELKNSIENLKKFLTDREWKVFMILYNNNNNLTDTAEVLKLSKQRVEQIRNKIRDKLVTICELDI
Ga0181419_10022723F053299GGAGMKNYKPYYRTDKMKQEELRTAKYVSILFFTMIGFSLIGFSFVLVKAMLYMTGLFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.