NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181388_1001823

Scaffold Ga0181388_1001823


Overview

Basic Information
Taxon OID3300017724 Open in IMG/M
Scaffold IDGa0181388_1001823 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6397
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047109Metagenome150N
F101291Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0181388_100182313F101291GGAGGMSKVNENWIGWNYKSRPDEIIELVLDEVNDMLKRSKIKINYQYNDDNEEGWDYFLELTKEYNGKEI
Ga0181388_100182315F047109AGGAGGMKTYKVIGEYTVYEHYEINVEAKDDKEAIAKAEKIPVEKWDELQNSNDGGFIIDDVWEEDENN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.