Scaffold Ga0181347_1096026

Overview

Basic Information

• Taxon OID: 3300017722
• Scaffold ID: Ga0181347_1096026
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 850
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002902	Metagenome / Metatranscriptome	522	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181347_10960262	F002902	AGGAG	MATITNNAIAKAGNGLGTRTRIINLAKSNMTQAELDAAILYLAQGETSGTDDAHTIAGVSVLTESGVFTTGVTDAVQVAIQGTGVCTVGSNFGVGSTGVTASLLAEFNQ