NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181373_1056211

Scaffold Ga0181373_1056211


Overview

Basic Information
Taxon OID3300017721 Open in IMG/M
Scaffold IDGa0181373_1056211 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)711
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-20.1Long. (o)-70.419Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025990Metagenome / Metatranscriptome199Y
F043915Metagenome / Metatranscriptome155N

Sequences

Protein IDFamilyRBSSequence
Ga0181373_10562111F043915GGAGVSNVINLMPTEATANEVLEECKGDFEHVLVIGWTPQEQLTAKATTSMEMKEIIYLIEVFKQAIITAGHEVE
Ga0181373_10562113F025990N/AGGMTKEHPAYRAQFYIQELKKYSTWPEYLAYYREQDDKIMQFSHYCMQMWSSYMNDKIKQKEAPLSYKQYLDKYKDLLEEGYNDRPED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.