| Basic Information | |
|---|---|
| Taxon OID | 3300017721 Open in IMG/M |
| Scaffold ID | Ga0181373_1035347 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Subarctic Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.1 | Long. (o) | -70.419 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013703 | Metagenome / Metatranscriptome | 269 | Y |
| F030559 | Metagenome / Metatranscriptome | 185 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181373_10353472 | F013703 | GGA | LSSSIGQISNENFFNINGMYGYRLPIPFRGNQINLQTFISYTFFRYYEGLKTENKYLLLESPILIYPGASIDINFTETFKMNFGMYIGYNTLVNDIGERNISYSIVFGTNF |
| Ga0181373_10353473 | F030559 | AGGAG | MKKLWSIILLIGLVNAQMPEPTMVGQDKLQIPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDYEMTARVIYIGRPRKSTTVLGLFRRETTTTEVRVVVELLNKKTGVVKSGNGV |
| ⦗Top⦘ |