Scaffold Ga0181373_1033870

Overview

Basic Information

• Taxon OID: 3300017721
• Scaffold ID: Ga0181373_1033870
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 942
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -20.1
  • Long. (^o): -70.419
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002412	Metagenome / Metatranscriptome	561	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181373_10338701	F002412	N/A	MRTFVIYSLMMVCAVAFHDNTFAVFELKEQLQMLYINMWELLHQLEYVTDEQRAVVYGEIDDIRQQIWDTIELLKQHDKTQHP