NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181412_1068448

Scaffold Ga0181412_1068448


Overview

Basic Information
Taxon OID3300017714 Open in IMG/M
Scaffold IDGa0181412_1068448 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)870
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041249Metagenome160Y
F085570Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0181412_10684482F041249GGAMDEEQLLKSTSKRTRRNANTIKYGMFGLSLGERNYNRLHEYCTRHNLYKATLVKSLIVDYLDRAEQKTKDKQ
Ga0181412_10684483F085570AGGAMHIDSYKIWSYDYDFKNGKKSKTTSIKQHLISEECIDSKSLINLLSDLDVAWHNVYDKKIKVEITFEPHEGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.