NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181412_1004366

Scaffold Ga0181412_1004366


Overview

Basic Information
Taxon OID3300017714 Open in IMG/M
Scaffold IDGa0181412_1004366 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4771
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002902Metagenome / Metatranscriptome522Y
F035114Metagenome173Y
F070047Metagenome / Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
Ga0181412_100436611F002902GGAGMAEITNNAVSKAGNGLGPRTRIINLAKTNITQAELDAALLYLAAGDVAGTNDAHFIAGVSVLTESGVFTGGTTDAVQVAIQGSGVFTAASNFGTGSTGITSSLLADFDQIPL
Ga0181412_10043662F070047GAGMYTTVDMRKLQDRLTAMTEVAEEAAPVQEQPEAAPAVEEAPIENSNGDAELAELKDMLGRSGVMGFTQ
Ga0181412_10043664F035114AGGMTASILQFPKQQTLHQRIDRLLDFVPEIRISKLKHGSVKVNDIVIDNRYGAWTCKDENFYRRKSAVGYALCLLHNDHIKAKAIKELDRKLQKVKTDIDFYHYHLRGTNQVRKNIMSHRISADMPMLHEADAALTQLLKTISVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.