NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181403_1007381

Scaffold Ga0181403_1007381


Overview

Basic Information
Taxon OID3300017710 Open in IMG/M
Scaffold IDGa0181403_1007381 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2388
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F003678Metagenome / Metatranscriptome474Y
F058963Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0181403_10073812F003678GGAMLYAPLIIASIALILCLYACVRVGQFINASRGLDWDAVANITGDLATTKKTIQTLNNRLNGMHSPKLADQELMMQLMQRQPNQQMNGTIKNVGG
Ga0181403_10073814F000613AGGAGMPLVKKRLSIAAGATSDQVLAGTTYEYVDPGTRIVVAAAVDTVGTATADTTMDFNVNNSEFSKNASVSALVTGEPFGWNGNYAMNDMVTQGAVRNRPVITFTNGTAATRTVDVAVFIGG
Ga0181403_10073815F058963N/APVVTKAALRKTKTTVRRLKSMCDMYDSLRPTATRRKAPMRRASTTLISNK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.