NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181403_1004305

Scaffold Ga0181403_1004305


Overview

Basic Information
Taxon OID3300017710 Open in IMG/M
Scaffold IDGa0181403_1004305 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3142
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
unclassified Hyphomonas → Hyphomonas sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005038Metagenome / Metatranscriptome414Y
F005431Metagenome / Metatranscriptome401Y
F008721Metagenome / Metatranscriptome329Y

Sequences

Protein IDFamilyRBSSequence
Ga0181403_10043052F008721GGAGMKNKFIKRYAKGIKLDVRNKGTCYVTMKTNAGELTVYIDAMDGLTDPPMVSAWIPGRRTKEVFIK
Ga0181403_10043054F005038AGGAGGMKAKDINIYNIFAATYKRKLFSFNGFGELSLMPKVKKPLRQISNVYQFPIKQYYNQKRRV
Ga0181403_10043058F005431AGGAMMDFDDNEKGYSAVIYIMESSNSVVVHFGGFNDLRECRYFSHNIMEDFGIEQLLNVPQGVTVH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.