Scaffold Ga0181369_1122923

Overview

Basic Information

• Taxon OID: 3300017708
• Scaffold ID: Ga0181369_1122923
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -20.099
  • Long. (^o): -70.892
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068250	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181369_11229232	F068250	AGGAG	MAGRIVGSDVKTATSTSSATGGAVLQAGRSRLRGYVIAGGSSDGTVTFRDGSVTGTTLLIAPCNANDTE