Basic Information | |
---|---|
Taxon OID | 3300017708 Open in IMG/M |
Scaffold ID | Ga0181369_1107316 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 577 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Subarctic Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.099 | Long. (o) | -70.892 | Alt. (m) | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001411 | Metagenome / Metatranscriptome | 701 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0181369_11073162 | F001411 | N/A | YTKLKEHGEDMTHENESKVDPKEDRGSLDLTFIIEQHKKEIWEYKQKESEWIKTENLANGYKKVIEELSAKLIDQVRVIAELEQEIKRLVAENKKXE |
⦗Top⦘ |