Scaffold Ga0181369_1084637

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181369_1084637

Scaffold Ga0181369_1084637

Overview

Basic Information
Taxon OID	3300017708 Open in IMG/M
Scaffold ID	Ga0181369_1084637 Open in IMG/M
Source Dataset Name	Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	672
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Subarctic Pacific Ocean
Coordinates	Lat. (^o)	-20.099	Long. (^o)	-70.892	Alt. (m)		Depth (m)	20
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031151	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181369_10846371	F031151	N/A	LGASEFKERAFQWKMLGYQKKVEVSIEDIPFVGYTDFHFEDKNTKEDFFIDLKTSKTNPMQISTSHAMQQSIYHRATNARQMLWYLKTPTKTKPAEFTQLELATYDHHLNICKHIVKVMGNFLKSVNSKDDVKMALIPNPDNWIWKEETVLNARKEVWGY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.