NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181369_1048020

Scaffold Ga0181369_1048020


Overview

Basic Information
Taxon OID3300017708 Open in IMG/M
Scaffold IDGa0181369_1048020 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)962
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-20.099Long. (o)-70.892Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045687Metagenome / Metatranscriptome152Y
F101865Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0181369_10480202F101865N/AMKIKDLIKELKYYDEETDFAIKLVVDPHDSEKDVLVNWVGEIDTSLLDQSYIEFGVEKXLRYLQMHQWNYKY
Ga0181369_10480205F045687AGGAGGMIRLIDITDDDIKNGTQCDNNKCAIARALKREYKTDDISVYIPDDISTPILLVNRKELNIRHENDVLDFIDCYDYMGDDYYPEPKPFTLEVVEXKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.