Scaffold Ga0181377_1015950

Overview

Basic Information

• Taxon OID: 3300017706
• Scaffold ID: Ga0181377_1015950
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1705
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -29.499
  • Long. (^o): -71.609
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065684	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181377_10159501	F065684	AGGA	MSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDG