NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181377_1000994

Scaffold Ga0181377_1000994


Overview

Basic Information
Taxon OID3300017706 Open in IMG/M
Scaffold IDGa0181377_1000994 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9676
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-29.499Long. (o)-71.609Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058462Metagenome / Metatranscriptome135Y
F068147Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0181377_10009943F058462AGGAMTTFDTPINLTTTGQYPIRAHMVFDNIGPNNCEDILWQNVIDSVSEIEGNEMGVSVTQSYQYTKLNTEPTIMVRWQGIKTENGNEFRIGLGKGIPGSKMTPPIMSGNMKTGVQVNGTLSIQSIKLGCVGGQFAIERDGKWYAIQIGEAIE
Ga0181377_10009947F068147AGGMIKGQKDWDYQFVSDCEIVNVFIPKNTHLSDHEELKQKLLLLQQVECDNHLTSSIVNLYNTSSIDWITHVRKMGHKYVAFWFDGCWPKTEGIEKKILNYITRLEKKDWITAVHPKYLDSLMLLNIDEFIAWPAKAPNFGNYKFWAENWISDCTVELSKTIERNIVVGAPQTDPENFLNGLMNKKYTDHTISRGARVIIKRKNIPSSPVYFVNTEPLDVDIIEQNKGKIYQQYVGTTAGFKLLYNAYNYGFDLHSTKFVWYDFDAYSLKFKRLMVEYWDGIDYPSFVEEFCKKYPEANSLLLKDAKKQWASIIEHFGGENNWLDFWCQVGCMEHEFIEVDLISGHKQITDKLDNVSTFFWTSNIYSYVLLKVMSEPFTLERSFADLVTRLQQIDNCWFFGTDPNDNNLNCNVRSILGYSTNESIGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.