Scaffold Ga0187310_15929

Overview

Basic Information

• Taxon OID: 3300017696
• Scaffold ID: Ga0187310_15929
• Source Dataset Name: Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 6. Combined Assembly of Gp0212723, Gp0212724
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Stanford University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7330
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (93.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location

• Location Name: YNP, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.428
  • Long. (^o): -110.5885

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018029	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187310_1592915	F018029	GAGG	MNLPQIIVKKIRKDELDEEEMRDLIDYLNVLKEGLQKLRIILYSPFGYIVDFDVVFNDPWYCSEVHLRLLNGEHGLLYLDSFIRRIFTDQIEVKPFISEVTHQ