Scaffold Ga0182746_1145090

Overview

Basic Information

• Taxon OID: 3300017652
• Scaffold ID: Ga0182746_1145090
• Source Dataset Name: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig OP (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 807
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034190	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182746_11450901	F034190	N/A	WCFINAVLGLMSPSATHPCPICIVSKNNLLSSSRYRTPADRHSIDHTHSPLLSIPPERIVPTPLHLFLGISNRIILDAFSELLGKERVETALKSITTVHSAGCGGAADLYDLNGQEISKWIKKECSATLLSAAAASSPIPAATSASHSILSRWLQQLHHCLLRSDVWTAADIDAWRSVVSDIHQHWRAETSIAAFPKLHMLHHSVDFAERHRFLGRASEAQIESFHASFNDLFHKQHRNQAGNTAERLRRCLADSSLRAVQSVLI