Scaffold Ga0182736_1219756

Overview

Basic Information

• Taxon OID: 3300017650
• Scaffold ID: Ga0182736_1219756
• Source Dataset Name: Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft BY (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027578	Metagenome / Metatranscriptome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182736_12197562	F027578	GGAG	MDRRSLFGLTAAAGGLLAARTVLPANAQATGPAHHGEPKLEPLPKIAQQQQFRIGYTTNTRGGWESDVFLGISEGREIGFRYFEIFGASFCATPNGMNAPPRDKQPMKAWPDGYSWKYDSVKVTKREVYYADRW