NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180216_1040617

Scaffold Ga0180216_1040617


Overview

Basic Information
Taxon OID3300017648 Open in IMG/M
Scaffold IDGa0180216_1040617 Open in IMG/M
Source Dataset NameEnriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C BE-Lig MG (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2054
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location NameUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014051Metagenome266Y

Sequences

Protein IDFamilyRBSSequence
Ga0180216_10406171F014051N/ATVTGHSKEICKEALKEFLAIDFWATKDDGLPQKKIDAVAALMKKVGAIKEDKQPVKYADFVDQSVWKDANAKVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.