Scaffold Ga0187698_102787

Overview

Basic Information

• Taxon OID: 3300017607
• Scaffold ID: Ga0187698_102787
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 679 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0197) (SRX549004-SRR1294390)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 759
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 43.1
  • Long. (^o): 70.782

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013498	Metatranscriptome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187698_1027872	F013498	N/A	MCKEVGAYPEHCTCPTYVDSTDKTPGVMTWDELLQYMDSLSSWGEETVKEWKKQAASQLQWTKKAVRVVQVSKACMAEDAKHREMVQNKLAGVCTDMCKEVGAYPDKCSCPNYVDTTDKTPNVVTWPELLNYMDKVESQGAEALKHWTSQAAR