Scaffold Ga0187703_10079

Overview

Basic Information

• Taxon OID: 3300017572
• Scaffold ID: Ga0187703_10079
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 329 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0196) (SRX548999-SRR1294385)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 556
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum micans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 43.1
  • Long. (^o): 70.782

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021306	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187703_100791	F021306	N/A	MEAMKEKAKKAIEDQMAEAAPGMIKPCFPCCGGPVGTIEKFIFMVPKDQQDQVKSAIEKYKSI