Basic Information | |
---|---|
Taxon OID | 3300017565 Open in IMG/M |
Scaffold ID | Ga0182745_1163981 Open in IMG/M |
Source Dataset Name | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft BY (version 2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1043 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Emeryville, California | |||||||
Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055568 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182745_11639812 | F055568 | GAGG | MMITIDPKLEARIRAKAQAEGLTVDAYVERLVSADQAAEEELETLALEGLQSGAPVEAGLQYWEEKHRRLDERLKHTGTC |
⦗Top⦘ |