Scaffold Ga0182747_1006596

Overview

Basic Information

• Taxon OID: 3300017560
• Scaffold ID: Ga0182747_1006596
• Source Dataset Name: Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig BY (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7254
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011188	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182747_10065963	F011188	GGAGG	VETYNIYMDELPTGEEFDGDEMVEVEFRVVPGSDDDGDPENNAVIAGLDLVDLINMRDALQQEIDNYALTALEVEASNLVEE