Scaffold Ga0186373_1061663

Overview

Basic Information

• Taxon OID: 3300017506
• Scaffold ID: Ga0186373_1061663
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 148 ?mol photons light - Neoceratium fusus PA161109 (MMETSP1075)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.57083
  • Long. (^o): -71.40517
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078184	Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186373_10616631	F078184	N/A	MAARRPAIALFMVAFALHSGVNFVSPRAAREQHGAQALSATVGIPVALVFPAVSEARQLNTFDNIFSNEPSLGALGVSWLSWNLVYFLLAVFALGAIVVFPVLAGVILGPAETMQEVRSKPGYVRREFRQPGLPGPAL