Basic Information | |
---|---|
Taxon OID | 3300017506 Open in IMG/M |
Scaffold ID | Ga0186373_1047825 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 148 ?mol photons light - Neoceratium fusus PA161109 (MMETSP1075) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 723 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 41.57083 | Long. (o) | -71.40517 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074346 | Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186373_10478252 | F074346 | GAG | MYVTGFNPEHPMKYQRYEQSLAELARELNGEDVPPSGQPDVVTWYDLDMKETRQCDMSEDDKQTCVSEVTTASSSARSSRNYEHFQLGASDAICQEADGVSVVNLLPVTSGSSRTAKRRFRRQRCRQKLRLMAQFPQVMTRELQEQDW |
⦗Top⦘ |