| Basic Information | |
|---|---|
| Taxon OID | 3300017493 Open in IMG/M |
| Scaffold ID | Ga0186467_1030171 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Derwent River in Gse medium, 18 C, 35 psu salinity and 319 ?mol photons light - Alexandrium margalefii AMGDE01CS-322 (MMETSP0661) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 722 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tasmania: Derwent River | |||||||
| Coordinates | Lat. (o) | 43.03333 | Long. (o) | 147.36667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022654 | Metatranscriptome | 213 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186467_10301711 | F022654 | N/A | DLADTCESCLAKGGGWCTVEQRCVEDDTAHCDAESLIGLAGFTNDCSADEERLRPKARPWIDKGVLVSYAFENGTCCMGEGIVSRAYHVLEEYTVLLRDSSREEVKLERWNNRKPAKKKDENSEYHNIEFRYFTPSELTVLSGIRPKDVVQAHFAVKQKKGSEDLLVKSRRTEEAVVVNTTVKTVAVNYTSDLIVSILPRDFVVDPTHEQVPPARFAHKEL |
| ⦗Top⦘ |