NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186467_1020200

Scaffold Ga0186467_1020200


Overview

Basic Information
Taxon OID3300017493 Open in IMG/M
Scaffold IDGa0186467_1020200 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Derwent River in Gse medium, 18 C, 35 psu salinity and 319 ?mol photons light - Alexandrium margalefii AMGDE01CS-322 (MMETSP0661)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)947
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameTasmania: Derwent River
CoordinatesLat. (o)43.03333Long. (o)147.36667Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019947Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0186467_10202002F019947N/AMAVASLPEDKPKILFYAAMMWVQNFGFFLMYFMMFQSIPSPASGECTNLRNWVGFFALDCFVESFVCIWMGMGGYTSDALLFPVMWILHLLVALPYCLCTVTIPLAIYSVDGTTCREGAGAPLYPLVPVYWTHAGLFIVYVWMMLSITYFSFLKPTFFSSPYRIHNDP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.