NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186434_1045653

Scaffold Ga0186434_1045653


Overview

Basic Information
Taxon OID3300017486 Open in IMG/M
Scaffold IDGa0186434_1045653 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with artificial seawater w/o silicate, 18 C, 28 psu salinity and 715 ?mol photons light - Lingulodinium polyedrum CCMP 1738 (MMETSP1033)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.8Long. (o)-97.13Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071920Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0186434_10456531F071920N/AKCPAYWELQAPHISRDFRLEDLPGYYYELAFHDVTQYPLCPGRSRCITSEKAIQKHADGARFVNDTWDLSCFGVAYPQQLLFNETDTPGYLLGYVPVTKIPFLPKGVVSSLVFPDTVVDFRAGPDGWALEFQCVEWLGAVRFVGINFYARRKTEAAFQEMLAAARARGLGYYMDSGLGLRRVDHGDCPKEPPAAAAPAIVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.