| Basic Information | |
|---|---|
| Taxon OID | 3300017484 Open in IMG/M |
| Scaffold ID | Ga0186656_1020438 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from South Pacific Ocean in L1 medium, 22 C, 20 psu salinity and 296 ?mol photons light - Karlodinium veneficum CCMP 2283 (MMETSP1016) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1292 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -32.2167 | Long. (o) | -80.7355 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015603 | Metagenome / Metatranscriptome | 253 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186656_10204381 | F015603 | N/A | MVDPRRTSAARHGLASIASNTRHIFRCCPQPASGRSFFHRNVLAAFVFVFRLRLAWAQACEHERYTDVVGTQMEIKDGETIYKDISANHTHRYFYSNYNVTTMNQPDTQRKLIINLEPCKGIVYVFVRKTRRCWPNPYSCIDIRPGQQRRRPADCTWTHFMSNIDGSRDGTPTFFEIPLSSTKYFLSVYAPQRSSYTLTLLADIGAFPRPGDNGKITARQMKELQVQISWNVAHFFPVGISDVKQYWVYSSMLLETDNRSNMAVFMRPSKIMNTVCGLQNNTDHQYDKIPATSCDAAGICNATIDGVVAQRKYVFNVVVESNRGFFFAYAGIIMRTDWQVIRQAASDTTLKVVGAVSGCVLGMVIIIYFLMLKLYG |
| ⦗Top⦘ |