Scaffold Ga0186435_1030515

Overview

Basic Information

• Taxon OID: 3300017483
• Scaffold ID: Ga0186435_1030515
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with artificial seawater w/o silicate, 18 C, 28 psu salinity and 698 ?mol photons light - Lingulodinium polyedrum CCMP 1738 (MMETSP1035)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 990
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Rhodophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.8
  • Long. (^o): -97.13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049390	Metatranscriptome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186435_10305151	F049390	N/A	MFRVVPSDLLGPVLGGLAYTVWYLCVVLRQLLRLLEPLMQGKPKTPYAGKTVLVTTGRQAKTLHGIRALKELGCRVVVTDYQEMSASAVSMACDATDTLAPLDPSRVGQWVEHLEAIIRRENVDLVVPMSTINEALFIGVAKDWLARRLPSVRFFCEGLEMMSRLDNKPLFSEMCEQCGVPVPESGIVSSRAELEAVVQQQGGGMDLILKRIESTINREEEIKVVPRGEQAPASVQPSPTDPWQWQRFIRGTEYSAWFVCVEGRITFQGCYRSEGDLLFFDGMPVPQDVETAIAGLVAKHRLTGQYAFDYFRE